Anti SLC4A8 pAb (ATL-HPA077895)

Atlas Antibodies

Catalog No.:
ATL-HPA077895-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 4 member 8
Gene Name: SLC4A8
Alternative Gene Name: NBC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023032: 98%, ENSRNOG00000028879: 97%
Entrez Gene ID: 9498
Uniprot ID: Q2Y0W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRV
Gene Sequence ELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRV
Gene ID - Mouse ENSMUSG00000023032
Gene ID - Rat ENSRNOG00000028879
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC4A8 pAb (ATL-HPA077895)
Datasheet Anti SLC4A8 pAb (ATL-HPA077895) Datasheet (External Link)
Vendor Page Anti SLC4A8 pAb (ATL-HPA077895) at Atlas Antibodies

Documents & Links for Anti SLC4A8 pAb (ATL-HPA077895)
Datasheet Anti SLC4A8 pAb (ATL-HPA077895) Datasheet (External Link)
Vendor Page Anti SLC4A8 pAb (ATL-HPA077895)