Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA079220-25
  • Immunohistochemistry analysis in human kidney and testis tissues using Anti-SLC4A4 antibody. Corresponding SLC4A4 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 4 member 4
Gene Name: SLC4A4
Alternative Gene Name: hhNMC, HNBC1, NBC1, NBC2, pNBC, SLC4A5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060961: 98%, ENSRNOG00000003134: 98%
Entrez Gene ID: 8671
Uniprot ID: Q9Y6R1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKF
Gene Sequence DIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKF
Gene ID - Mouse ENSMUSG00000060961
Gene ID - Rat ENSRNOG00000003134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation)
Datasheet Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC4A4 pAb (ATL-HPA079220 w/enhanced validation)