Anti SLC4A1 pAb (ATL-HPA063911 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063911-25
  • Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-SLC4A1 antibody. Corresponding SLC4A1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: solute carrier family 4 (anion exchanger), member 1 (Diego blood group)
Gene Name: SLC4A1
Alternative Gene Name: AE1, CD233, DI, EPB3, FR, RTA1A, SW, WD, WR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006574: 55%, ENSRNOG00000020951: 58%
Entrez Gene ID: 6521
Uniprot ID: P02730
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLT
Gene Sequence DDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLT
Gene ID - Mouse ENSMUSG00000006574
Gene ID - Rat ENSRNOG00000020951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SLC4A1 pAb (ATL-HPA063911 w/enhanced validation)
Datasheet Anti SLC4A1 pAb (ATL-HPA063911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC4A1 pAb (ATL-HPA063911 w/enhanced validation)