Anti SLC46A2 pAb (ATL-HPA020098)

Atlas Antibodies

Catalog No.: ATL-HPA020098-25

Protein Description: solute carrier family 46, member 2
Gene Name: SLC46A2
Alternative Gene Name: Ly110, TSCOT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028386: 60%, ENSRNOG00000017324: 62%
Entrez Gene ID: 57864
Uniprot ID: Q9BY10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPH
• Gene Sequence: KVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPH
• Gene ID - Mouse: ENSMUSG00000028386
• Gene ID - Rat: ENSRNOG00000017324
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.