Anti SLC45A3 pAb (ATL-HPA019075 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019075-25

Protein Description: solute carrier family 45, member 3
Gene Name: SLC45A3
Alternative Gene Name: IPCA-2, IPCA-6, IPCA-8, PCANAP2, PCANAP6, PCANAP8, prostein
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026435: 83%, ENSRNOG00000007591: 85%
Entrez Gene ID: 85414
Uniprot ID: Q96JT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
• Gene Sequence: PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
• Gene ID - Mouse: ENSMUSG00000026435
• Gene ID - Rat: ENSRNOG00000007591
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.