Anti SLC45A1 pAb (ATL-HPA078818)

Atlas Antibodies

Catalog No.:
ATL-HPA078818-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 45 member 1
Gene Name: SLC45A1
Alternative Gene Name: DNB5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039838: 86%, ENSRNOG00000018229: 86%
Entrez Gene ID: 50651
Uniprot ID: Q9Y2W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG
Gene Sequence QDRGLLEGREGALTSGCDGDILRVGSLDTSKPRSSGILKRPQTLAIPDAAGGGGPETSRRRNVTFSQQVANILLNG
Gene ID - Mouse ENSMUSG00000039838
Gene ID - Rat ENSRNOG00000018229
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC45A1 pAb (ATL-HPA078818)
Datasheet Anti SLC45A1 pAb (ATL-HPA078818) Datasheet (External Link)
Vendor Page Anti SLC45A1 pAb (ATL-HPA078818) at Atlas Antibodies

Documents & Links for Anti SLC45A1 pAb (ATL-HPA078818)
Datasheet Anti SLC45A1 pAb (ATL-HPA078818) Datasheet (External Link)
Vendor Page Anti SLC45A1 pAb (ATL-HPA078818)