Anti SLC44A5 pAb (ATL-HPA051011)

Atlas Antibodies

Catalog No.:
ATL-HPA051011-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 44, member 5
Gene Name: SLC44A5
Alternative Gene Name: CTL5, MGC34032
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028360: 67%, ENSRNOG00000042332: 69%
Entrez Gene ID: 204962
Uniprot ID: Q8NCS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPVYKVIAPGGHCIHENQTCDPEIFNTTEIAKACPGALCNFAFYGGKSLYHQYI
Gene Sequence VPVYKVIAPGGHCIHENQTCDPEIFNTTEIAKACPGALCNFAFYGGKSLYHQYI
Gene ID - Mouse ENSMUSG00000028360
Gene ID - Rat ENSRNOG00000042332
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC44A5 pAb (ATL-HPA051011)
Datasheet Anti SLC44A5 pAb (ATL-HPA051011) Datasheet (External Link)
Vendor Page Anti SLC44A5 pAb (ATL-HPA051011) at Atlas Antibodies

Documents & Links for Anti SLC44A5 pAb (ATL-HPA051011)
Datasheet Anti SLC44A5 pAb (ATL-HPA051011) Datasheet (External Link)
Vendor Page Anti SLC44A5 pAb (ATL-HPA051011)