Anti SLC44A4 pAb (ATL-HPA054176)

Atlas Antibodies

Catalog No.:
ATL-HPA054176-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 44, member 4
Gene Name: SLC44A4
Alternative Gene Name: C6orf29, CTL4, FLJ14491, NG22, TPPT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007034: 61%, ENSRNOG00000000878: 64%
Entrez Gene ID: 80736
Uniprot ID: Q53GD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFED
Gene Sequence MTVITSLQQELCPSFLLPSAPALGRCFPWTNVTPPALPGITNDTTIQQGISGLIDSLNARDISVKIFED
Gene ID - Mouse ENSMUSG00000007034
Gene ID - Rat ENSRNOG00000000878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC44A4 pAb (ATL-HPA054176)
Datasheet Anti SLC44A4 pAb (ATL-HPA054176) Datasheet (External Link)
Vendor Page Anti SLC44A4 pAb (ATL-HPA054176) at Atlas Antibodies

Documents & Links for Anti SLC44A4 pAb (ATL-HPA054176)
Datasheet Anti SLC44A4 pAb (ATL-HPA054176) Datasheet (External Link)
Vendor Page Anti SLC44A4 pAb (ATL-HPA054176)