Anti SLC44A1 pAb (ATL-HPA074007)

Atlas Antibodies

SKU:
ATL-HPA074007-25
  • Immunohistochemical staining of human caudate shows strong cytoplasmic positivity in glial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 44 member 1
Gene Name: SLC44A1
Alternative Gene Name: CD92, CDw92, CHTL1, CTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028412: 95%, ENSRNOG00000055089: 95%
Entrez Gene ID: 23446
Uniprot ID: Q8WWI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LFLCLAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASS
Gene Sequence LFLCLAIDTKYNDGSPGREFYMDKVLMEFVENSRKAMKEAGKGGVADSRELKPMASGASS
Gene ID - Mouse ENSMUSG00000028412
Gene ID - Rat ENSRNOG00000055089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC44A1 pAb (ATL-HPA074007)
Datasheet Anti SLC44A1 pAb (ATL-HPA074007) Datasheet (External Link)
Vendor Page Anti SLC44A1 pAb (ATL-HPA074007) at Atlas Antibodies

Documents & Links for Anti SLC44A1 pAb (ATL-HPA074007)
Datasheet Anti SLC44A1 pAb (ATL-HPA074007) Datasheet (External Link)
Vendor Page Anti SLC44A1 pAb (ATL-HPA074007)