Anti SLC43A3 pAb (ATL-HPA077244)

Atlas Antibodies

Catalog No.:
ATL-HPA077244-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 43 member 3
Gene Name: SLC43A3
Alternative Gene Name: DKFZp762A227, Eeg1, FOAP-13, PRO1659, SEEEG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027074: 51%, ENSRNOG00000061768: 54%
Entrez Gene ID: 29015
Uniprot ID: Q8NBI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFS
Gene Sequence FKNEDYFKDLCGPDAGPIGNATGQADCKAQDERFS
Gene ID - Mouse ENSMUSG00000027074
Gene ID - Rat ENSRNOG00000061768
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC43A3 pAb (ATL-HPA077244)
Datasheet Anti SLC43A3 pAb (ATL-HPA077244) Datasheet (External Link)
Vendor Page Anti SLC43A3 pAb (ATL-HPA077244) at Atlas Antibodies

Documents & Links for Anti SLC43A3 pAb (ATL-HPA077244)
Datasheet Anti SLC43A3 pAb (ATL-HPA077244) Datasheet (External Link)
Vendor Page Anti SLC43A3 pAb (ATL-HPA077244)