Anti SLC43A3 pAb (ATL-HPA030551)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030551-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC43A3
Alternative Gene Name: DKFZp762A227, Eeg1, FOAP-13, PRO1659, SEEEG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027074: 60%, ENSRNOG00000061768: 63%
Entrez Gene ID: 29015
Uniprot ID: Q8NBI5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSR |
| Gene Sequence | SFIFISVCSTWHVARTFLLMPRGHIPYPLPPNYSYGLCPGNGTTKEEKETAEHENRELQSKEFLSAKEETPGAGQKQELRSFWSYAFSR |
| Gene ID - Mouse | ENSMUSG00000027074 |
| Gene ID - Rat | ENSRNOG00000061768 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC43A3 pAb (ATL-HPA030551) | |
| Datasheet | Anti SLC43A3 pAb (ATL-HPA030551) Datasheet (External Link) |
| Vendor Page | Anti SLC43A3 pAb (ATL-HPA030551) at Atlas Antibodies |
| Documents & Links for Anti SLC43A3 pAb (ATL-HPA030551) | |
| Datasheet | Anti SLC43A3 pAb (ATL-HPA030551) Datasheet (External Link) |
| Vendor Page | Anti SLC43A3 pAb (ATL-HPA030551) |
| Citations for Anti SLC43A3 pAb (ATL-HPA030551) – 1 Found |
| Mender, Ilgen; Batten, Kimberly; Peyton, Michael; Vemula, Aishwarya; Cornelius, Crystal; Girard, Luc; Gao, Boning; Minna, John D; Shay, Jerry W. SLC43A3 Is a Biomarker of Sensitivity to the Telomeric DNA Damage Mediator 6-Thio-2'-Deoxyguanosine. Cancer Research. 2020;80(5):929-936. PubMed |