Anti SLC43A2 pAb (ATL-HPA021564 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021564-25

Protein Description: solute carrier family 43 (amino acid system L transporter), member 2
Gene Name: SLC43A2
Alternative Gene Name: MGC34680
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038178: 88%, ENSRNOG00000003835: 91%
Entrez Gene ID: 124935
Uniprot ID: Q8N370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV
• Gene Sequence: YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV
• Gene ID - Mouse: ENSMUSG00000038178
• Gene ID - Rat: ENSRNOG00000003835
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.