Anti SLC43A1 pAb (ATL-HPA018813)

Atlas Antibodies

Catalog No.: ATL-HPA018813-25

Protein Description: solute carrier family 43 (amino acid system L transporter), member 1
Gene Name: SLC43A1
Alternative Gene Name: PB39, POV1, R00504
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027075: 67%, ENSRNOG00000008243: 65%
Entrez Gene ID: 8501
Uniprot ID: O75387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ
• Gene Sequence: MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ
• Gene ID - Mouse: ENSMUSG00000027075
• Gene ID - Rat: ENSRNOG00000008243
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.