Anti SLC41A3 pAb (ATL-HPA045847)

Atlas Antibodies

Catalog No.:
ATL-HPA045847-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 41, member 3
Gene Name: SLC41A3
Alternative Gene Name: FLJ20473
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030089: 53%, ENSRNOG00000045821: 56%
Entrez Gene ID: 54946
Uniprot ID: Q96GZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTPKPLETEPSRETT
Gene Sequence MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTPKPLETEPSRETT
Gene ID - Mouse ENSMUSG00000030089
Gene ID - Rat ENSRNOG00000045821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC41A3 pAb (ATL-HPA045847)
Datasheet Anti SLC41A3 pAb (ATL-HPA045847) Datasheet (External Link)
Vendor Page Anti SLC41A3 pAb (ATL-HPA045847) at Atlas Antibodies

Documents & Links for Anti SLC41A3 pAb (ATL-HPA045847)
Datasheet Anti SLC41A3 pAb (ATL-HPA045847) Datasheet (External Link)
Vendor Page Anti SLC41A3 pAb (ATL-HPA045847)