Anti SLC3A1 pAb (ATL-HPA071102)

Atlas Antibodies

Catalog No.:
ATL-HPA071102-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: solute carrier family 3 member 1
Gene Name: SLC3A1
Alternative Gene Name: ATR1, CSNU1, D2H, NBAT, RBAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024131: 89%, ENSRNOG00000007006: 89%
Entrez Gene ID: 6519
Uniprot ID: Q07837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN
Gene Sequence SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN
Gene ID - Mouse ENSMUSG00000024131
Gene ID - Rat ENSRNOG00000007006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC3A1 pAb (ATL-HPA071102)
Datasheet Anti SLC3A1 pAb (ATL-HPA071102) Datasheet (External Link)
Vendor Page Anti SLC3A1 pAb (ATL-HPA071102) at Atlas Antibodies

Documents & Links for Anti SLC3A1 pAb (ATL-HPA071102)
Datasheet Anti SLC3A1 pAb (ATL-HPA071102) Datasheet (External Link)
Vendor Page Anti SLC3A1 pAb (ATL-HPA071102)