Anti SLC39A8 pAb (ATL-HPA038833)

Atlas Antibodies

Catalog No.: ATL-HPA038833-25

Protein Description: solute carrier family 39 (zinc transporter), member 8
Gene Name: SLC39A8
Alternative Gene Name: BIGM103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053897: 74%, ENSRNOG00000012508: 73%
Entrez Gene ID: 64116
Uniprot ID: Q9C0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHS
• Gene Sequence: ANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHS
• Gene ID - Mouse: ENSMUSG00000053897
• Gene ID - Rat: ENSRNOG00000012508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC39A8 pAb (ATL-HPA038833) – 2 Found

Balusikova, Kamila; Dostalikova-Cimburova, Marketa; Tacheci, Ilja; Kovar, Jan. Expression profiles of iron transport molecules along the duodenum. Journal Of Cellular And Molecular Medicine. 2022;26(10):2995-3004. 

Haller, Gabe; McCall, Kevin; Jenkitkasemwong, Supak; Sadler, Brooke; Antunes, Lilian; Nikolov, Momchil; Whittle, Julia; Upshaw, Zachary; Shin, Jimann; Baschal, Erin; Cruchaga, Carlos; Harms, Matthew; Raggio, Cathleen; Morcuende, Jose A; Giampietro, Philip; Miller, Nancy H; Wise, Carol; Gray, Ryan S; Solnica-Krezel, Lila; Knutson, Mitchell; Dobbs, Matthew B; Gurnett, Christina A. A missense variant in SLC39A8 is associated with severe idiopathic scoliosis. Nature Communications. 2018;9(1):4171.