Anti SLC39A8 pAb (ATL-HPA038832)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038832-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC39A8
Alternative Gene Name: BIGM103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053897: 84%, ENSRNOG00000012508: 80%
Entrez Gene ID: 64116
Uniprot ID: Q9C0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL |
| Gene Sequence | LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL |
| Gene ID - Mouse | ENSMUSG00000053897 |
| Gene ID - Rat | ENSRNOG00000012508 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC39A8 pAb (ATL-HPA038832) | |
| Datasheet | Anti SLC39A8 pAb (ATL-HPA038832) Datasheet (External Link) |
| Vendor Page | Anti SLC39A8 pAb (ATL-HPA038832) at Atlas Antibodies |
| Documents & Links for Anti SLC39A8 pAb (ATL-HPA038832) | |
| Datasheet | Anti SLC39A8 pAb (ATL-HPA038832) Datasheet (External Link) |
| Vendor Page | Anti SLC39A8 pAb (ATL-HPA038832) |
| Citations for Anti SLC39A8 pAb (ATL-HPA038832) – 2 Found |
| Lin, Wen; Vann, David R; Doulias, Paschalis-Thomas; Wang, Tao; Landesberg, Gavin; Li, Xueli; Ricciotti, Emanuela; Scalia, Rosario; He, Miao; Hand, Nicholas J; Rader, Daniel J. Hepatic metal ion transporter ZIP8 regulates manganese homeostasis and manganese-dependent enzyme activity. The Journal Of Clinical Investigation. 2017;127(6):2407-2417. PubMed |
| Sunuwar, Laxmi; Frkatović, Azra; Sharapov, Sodbo; Wang, Qinchuan; Neu, Heather M; Wu, Xinqun; Haritunians, Talin; Wan, Fengyi; Michel, Sarah; Wu, Shaoguang; Donowitz, Mark; McGovern, Dermot; Lauc, Gordan; Sears, Cynthia; Melia, Joanna. Pleiotropic ZIP8 A391T implicates abnormal manganese homeostasis in complex human disease. Jci Insight. 2020;5(20) PubMed |