Anti SLC39A8 pAb (ATL-HPA038832)

Atlas Antibodies

Catalog No.: ATL-HPA038832-25

Protein Description: solute carrier family 39 (zinc transporter), member 8
Gene Name: SLC39A8
Alternative Gene Name: BIGM103
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053897: 84%, ENSRNOG00000012508: 80%
Entrez Gene ID: 64116
Uniprot ID: Q9C0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
• Gene Sequence: LKTYGQNGHTHFGNDNFGPQEKTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCL
• Gene ID - Mouse: ENSMUSG00000053897
• Gene ID - Rat: ENSRNOG00000012508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SLC39A8 pAb (ATL-HPA038832) – 2 Found

Lin, Wen; Vann, David R; Doulias, Paschalis-Thomas; Wang, Tao; Landesberg, Gavin; Li, Xueli; Ricciotti, Emanuela; Scalia, Rosario; He, Miao; Hand, Nicholas J; Rader, Daniel J. Hepatic metal ion transporter ZIP8 regulates manganese homeostasis and manganese-dependent enzyme activity. The Journal Of Clinical Investigation. 2017;127(6):2407-2417. 

Sunuwar, Laxmi; Frkatović, Azra; Sharapov, Sodbo; Wang, Qinchuan; Neu, Heather M; Wu, Xinqun; Haritunians, Talin; Wan, Fengyi; Michel, Sarah; Wu, Shaoguang; Donowitz, Mark; McGovern, Dermot; Lauc, Gordan; Sears, Cynthia; Melia, Joanna. Pleiotropic ZIP8 A391T implicates abnormal manganese homeostasis in complex human disease. Jci Insight. 2020;5(20)