Anti SLC39A2 pAb (ATL-HPA073231)

Atlas Antibodies

Catalog No.:
ATL-HPA073231-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 39 member 2
Gene Name: SLC39A2
Alternative Gene Name: ZIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072572: 66%, ENSRNOG00000010375: 66%
Entrez Gene ID: 29986
Uniprot ID: Q9NP94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPY
Gene Sequence MTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPY
Gene ID - Mouse ENSMUSG00000072572
Gene ID - Rat ENSRNOG00000010375
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC39A2 pAb (ATL-HPA073231)
Datasheet Anti SLC39A2 pAb (ATL-HPA073231) Datasheet (External Link)
Vendor Page Anti SLC39A2 pAb (ATL-HPA073231) at Atlas Antibodies

Documents & Links for Anti SLC39A2 pAb (ATL-HPA073231)
Datasheet Anti SLC39A2 pAb (ATL-HPA073231) Datasheet (External Link)
Vendor Page Anti SLC39A2 pAb (ATL-HPA073231)