Anti SLC39A2 pAb (ATL-HPA030489)

Atlas Antibodies

Catalog No.: ATL-HPA030489-25

Protein Description: solute carrier family 39 (zinc transporter), member 2
Gene Name: SLC39A2
Alternative Gene Name: ZIP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072572: 71%, ENSRNOG00000010375: 71%
Entrez Gene ID: 29986
Uniprot ID: Q9NP94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPS
• Gene Sequence: QCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPS
• Gene ID - Mouse: ENSMUSG00000072572
• Gene ID - Rat: ENSRNOG00000010375
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.