Anti SLC38A1 pAb (ATL-HPA052272)

Atlas Antibodies

SKU:
ATL-HPA052272-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 38, member 1
Gene Name: SLC38A1
Alternative Gene Name: ATA1, NAT2, SAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023169: 97%, ENSRNOG00000005291: 97%
Entrez Gene ID: 81539
Uniprot ID: Q9H2H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT
Gene Sequence KSGLELTELQNMTVPEDDNISNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKKKCDEYIPGT
Gene ID - Mouse ENSMUSG00000023169
Gene ID - Rat ENSRNOG00000005291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC38A1 pAb (ATL-HPA052272)
Datasheet Anti SLC38A1 pAb (ATL-HPA052272) Datasheet (External Link)
Vendor Page Anti SLC38A1 pAb (ATL-HPA052272) at Atlas Antibodies

Documents & Links for Anti SLC38A1 pAb (ATL-HPA052272)
Datasheet Anti SLC38A1 pAb (ATL-HPA052272) Datasheet (External Link)
Vendor Page Anti SLC38A1 pAb (ATL-HPA052272)



Citations for Anti SLC38A1 pAb (ATL-HPA052272) – 2 Found
Liu, Pin; Calvisi, Diego F; Kiss, Andras; Cigliano, Antonio; Schaff, Zsuzsa; Che, Li; Ribback, Silvia; Dombrowski, Frank; Zhao, Dongchi; Chen, Xin. Central role of mTORC1 downstream of YAP/TAZ in hepatoblastoma development. Oncotarget. 2017;8(43):73433-73447.  PubMed
Böhme-Schäfer, Ines; Lörentz, Sandra; Bosserhoff, Anja Katrin. Role of Amino Acid Transporter SNAT1/SLC38A1 in Human Melanoma. Cancers. 2022;14(9)  PubMed