Anti SLC36A4 pAb (ATL-HPA017887)

Atlas Antibodies

Catalog No.:
ATL-HPA017887-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 36 (proton/amino acid symporter), member 4
Gene Name: SLC36A4
Alternative Gene Name: FLJ38932, PAT4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043885: 84%, ENSRNOG00000011455: 89%
Entrez Gene ID: 120103
Uniprot ID: Q6YBV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGL
Gene Sequence REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGL
Gene ID - Mouse ENSMUSG00000043885
Gene ID - Rat ENSRNOG00000011455
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC36A4 pAb (ATL-HPA017887)
Datasheet Anti SLC36A4 pAb (ATL-HPA017887) Datasheet (External Link)
Vendor Page Anti SLC36A4 pAb (ATL-HPA017887) at Atlas Antibodies

Documents & Links for Anti SLC36A4 pAb (ATL-HPA017887)
Datasheet Anti SLC36A4 pAb (ATL-HPA017887) Datasheet (External Link)
Vendor Page Anti SLC36A4 pAb (ATL-HPA017887)