Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049229-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member F5
Gene Name: SLC35F5
Alternative Gene Name: FLJ22004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026342: 74%, ENSRNOG00000003403: 74%
Entrez Gene ID: 80255
Uniprot ID: Q8WV83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLSSSPPFRLRSAKFSGIALEDLRRALKTRLQMVCVFVMNRMNSQNSGFTQRR
Gene Sequence VLSSSPPFRLRSAKFSGIALEDLRRALKTRLQMVCVFVMNRMNSQNSGFTQRR
Gene ID - Mouse ENSMUSG00000026342
Gene ID - Rat ENSRNOG00000003403
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation)
Datasheet Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation)
Datasheet Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC35F5 pAb (ATL-HPA049229 w/enhanced validation)