Anti SLC35F3 pAb (ATL-HPA051327)

Atlas Antibodies

Catalog No.:
ATL-HPA051327-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member F3
Gene Name: SLC35F3
Alternative Gene Name: FLJ37712
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057060: 97%, ENSRNOG00000049456: 100%
Entrez Gene ID: 148641
Uniprot ID: Q8IY50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HVCKSTEKQSVKQRYRECCRFFGDNGLTLK
Gene Sequence HVCKSTEKQSVKQRYRECCRFFGDNGLTLK
Gene ID - Mouse ENSMUSG00000057060
Gene ID - Rat ENSRNOG00000049456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35F3 pAb (ATL-HPA051327)
Datasheet Anti SLC35F3 pAb (ATL-HPA051327) Datasheet (External Link)
Vendor Page Anti SLC35F3 pAb (ATL-HPA051327) at Atlas Antibodies

Documents & Links for Anti SLC35F3 pAb (ATL-HPA051327)
Datasheet Anti SLC35F3 pAb (ATL-HPA051327) Datasheet (External Link)
Vendor Page Anti SLC35F3 pAb (ATL-HPA051327)