Anti SLC35F2 pAb (ATL-HPA050695)

Atlas Antibodies

Catalog No.:
ATL-HPA050695-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member F2
Gene Name: SLC35F2
Alternative Gene Name: FLJ13018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042195: 55%, ENSRNOG00000009014: 55%
Entrez Gene ID: 54733
Uniprot ID: Q8IXU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN
Gene Sequence MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWN
Gene ID - Mouse ENSMUSG00000042195
Gene ID - Rat ENSRNOG00000009014
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35F2 pAb (ATL-HPA050695)
Datasheet Anti SLC35F2 pAb (ATL-HPA050695) Datasheet (External Link)
Vendor Page Anti SLC35F2 pAb (ATL-HPA050695) at Atlas Antibodies

Documents & Links for Anti SLC35F2 pAb (ATL-HPA050695)
Datasheet Anti SLC35F2 pAb (ATL-HPA050695) Datasheet (External Link)
Vendor Page Anti SLC35F2 pAb (ATL-HPA050695)