Anti SLC35F1 pAb (ATL-HPA019576 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019576-25

Protein Description: solute carrier family 35, member F1
Gene Name: SLC35F1
Alternative Gene Name: C6orf169, dJ230I3.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038602: 98%, ENSRNOG00000000412: 95%
Entrez Gene ID: 222553
Uniprot ID: Q5T1Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA
• Gene Sequence: RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA
• Gene ID - Mouse: ENSMUSG00000038602
• Gene ID - Rat: ENSRNOG00000000412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.