Anti SLC35E2 pAb (ATL-HPA062711)
Atlas Antibodies
- SKU:
- ATL-HPA062711-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SLC35E2
Alternative Gene Name: KIAA0447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070319: 34%, ENSRNOG00000010457: 34%
Entrez Gene ID: 9906
Uniprot ID: P0CK97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP |
Gene Sequence | LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP |
Gene ID - Mouse | ENSMUSG00000070319 |
Gene ID - Rat | ENSRNOG00000010457 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC35E2 pAb (ATL-HPA062711) | |
Datasheet | Anti SLC35E2 pAb (ATL-HPA062711) Datasheet (External Link) |
Vendor Page | Anti SLC35E2 pAb (ATL-HPA062711) at Atlas Antibodies |
Documents & Links for Anti SLC35E2 pAb (ATL-HPA062711) | |
Datasheet | Anti SLC35E2 pAb (ATL-HPA062711) Datasheet (External Link) |
Vendor Page | Anti SLC35E2 pAb (ATL-HPA062711) |