Anti SLC35E2 pAb (ATL-HPA062711)

Atlas Antibodies

Catalog No.:
ATL-HPA062711-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member E2
Gene Name: SLC35E2
Alternative Gene Name: KIAA0447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070319: 34%, ENSRNOG00000010457: 34%
Entrez Gene ID: 9906
Uniprot ID: P0CK97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP
Gene Sequence LGEYTGRPSDREEWEELQLQPGRGAAASDRRSPVPPSERHGVRPHGENLP
Gene ID - Mouse ENSMUSG00000070319
Gene ID - Rat ENSRNOG00000010457
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35E2 pAb (ATL-HPA062711)
Datasheet Anti SLC35E2 pAb (ATL-HPA062711) Datasheet (External Link)
Vendor Page Anti SLC35E2 pAb (ATL-HPA062711) at Atlas Antibodies

Documents & Links for Anti SLC35E2 pAb (ATL-HPA062711)
Datasheet Anti SLC35E2 pAb (ATL-HPA062711) Datasheet (External Link)
Vendor Page Anti SLC35E2 pAb (ATL-HPA062711)