Anti SLC35D3 pAb (ATL-HPA030431)

Atlas Antibodies

Catalog No.: ATL-HPA030431-25

Protein Description: solute carrier family 35, member D3
Gene Name: SLC35D3
Alternative Gene Name: FRCL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050473: 63%, ENSRNOG00000012311: 71%
Entrez Gene ID: 340146
Uniprot ID: Q5M8T2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM
• Gene Sequence: RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM
• Gene ID - Mouse: ENSMUSG00000050473
• Gene ID - Rat: ENSRNOG00000012311
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.