Anti SLC35C2 pAb (ATL-HPA027011)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027011-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC35C2
Alternative Gene Name: bA394O2.1, C20orf5, CGI-15, OVCOV1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017664: 83%, ENSRNOG00000018649: 80%
Entrez Gene ID: 51006
Uniprot ID: Q9NQQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ |
| Gene Sequence | KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ |
| Gene ID - Mouse | ENSMUSG00000017664 |
| Gene ID - Rat | ENSRNOG00000018649 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC35C2 pAb (ATL-HPA027011) | |
| Datasheet | Anti SLC35C2 pAb (ATL-HPA027011) Datasheet (External Link) |
| Vendor Page | Anti SLC35C2 pAb (ATL-HPA027011) at Atlas Antibodies |
| Documents & Links for Anti SLC35C2 pAb (ATL-HPA027011) | |
| Datasheet | Anti SLC35C2 pAb (ATL-HPA027011) Datasheet (External Link) |
| Vendor Page | Anti SLC35C2 pAb (ATL-HPA027011) |