Anti SLC35B3 pAb (ATL-HPA057801)
Atlas Antibodies
- SKU:
- ATL-HPA057801-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC35B3
Alternative Gene Name: C6orf196, CGI-19, dJ453H5.1, PAPST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021432: 59%, ENSRNOG00000016174: 64%
Entrez Gene ID: 51000
Uniprot ID: Q9H1N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL |
Gene Sequence | QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL |
Gene ID - Mouse | ENSMUSG00000021432 |
Gene ID - Rat | ENSRNOG00000016174 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC35B3 pAb (ATL-HPA057801) | |
Datasheet | Anti SLC35B3 pAb (ATL-HPA057801) Datasheet (External Link) |
Vendor Page | Anti SLC35B3 pAb (ATL-HPA057801) at Atlas Antibodies |
Documents & Links for Anti SLC35B3 pAb (ATL-HPA057801) | |
Datasheet | Anti SLC35B3 pAb (ATL-HPA057801) Datasheet (External Link) |
Vendor Page | Anti SLC35B3 pAb (ATL-HPA057801) |