Anti SLC35B3 pAb (ATL-HPA057801)

Atlas Antibodies

SKU:
ATL-HPA057801-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3
Gene Name: SLC35B3
Alternative Gene Name: C6orf196, CGI-19, dJ453H5.1, PAPST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021432: 59%, ENSRNOG00000016174: 64%
Entrez Gene ID: 51000
Uniprot ID: Q9H1N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
Gene Sequence QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
Gene ID - Mouse ENSMUSG00000021432
Gene ID - Rat ENSRNOG00000016174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC35B3 pAb (ATL-HPA057801)
Datasheet Anti SLC35B3 pAb (ATL-HPA057801) Datasheet (External Link)
Vendor Page Anti SLC35B3 pAb (ATL-HPA057801) at Atlas Antibodies

Documents & Links for Anti SLC35B3 pAb (ATL-HPA057801)
Datasheet Anti SLC35B3 pAb (ATL-HPA057801) Datasheet (External Link)
Vendor Page Anti SLC35B3 pAb (ATL-HPA057801)