Anti SLC35B3 pAb (ATL-HPA057801)

Atlas Antibodies

Catalog No.: ATL-HPA057801-25

Protein Description: solute carrier family 35 (adenosine 3'-phospho 5'-phosphosulfate transporter), member B3
Gene Name: SLC35B3
Alternative Gene Name: C6orf196, CGI-19, dJ453H5.1, PAPST2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021432: 59%, ENSRNOG00000016174: 64%
Entrez Gene ID: 51000
Uniprot ID: Q9H1N7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
• Gene Sequence: QQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNL
• Gene ID - Mouse: ENSMUSG00000021432
• Gene ID - Rat: ENSRNOG00000016174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.