Anti SLC35B1 pAb (ATL-HPA057418)

Atlas Antibodies

Catalog No.:
ATL-HPA057418-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member B1
Gene Name: SLC35B1
Alternative Gene Name: UGTREL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020873: 100%, ENSRNOG00000004510: 100%
Entrez Gene ID: 10237
Uniprot ID: P78383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
Gene Sequence QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
Gene ID - Mouse ENSMUSG00000020873
Gene ID - Rat ENSRNOG00000004510
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35B1 pAb (ATL-HPA057418)
Datasheet Anti SLC35B1 pAb (ATL-HPA057418) Datasheet (External Link)
Vendor Page Anti SLC35B1 pAb (ATL-HPA057418) at Atlas Antibodies

Documents & Links for Anti SLC35B1 pAb (ATL-HPA057418)
Datasheet Anti SLC35B1 pAb (ATL-HPA057418) Datasheet (External Link)
Vendor Page Anti SLC35B1 pAb (ATL-HPA057418)
Citations for Anti SLC35B1 pAb (ATL-HPA057418) – 1 Found
Klein, Marie-Christine; Zimmermann, Katharina; Schorr, Stefan; Landini, Martina; Klemens, Patrick A W; Altensell, Jacqueline; Jung, Martin; Krause, Elmar; Nguyen, Duy; Helms, Volkhard; Rettig, Jens; Fecher-Trost, Claudia; Cavalié, Adolfo; Hoth, Markus; Bogeski, Ivan; Neuhaus, H Ekkehard; Zimmermann, Richard; Lang, Sven; Haferkamp, Ilka. AXER is an ATP/ADP exchanger in the membrane of the endoplasmic reticulum. Nature Communications. 2018;9(1):3489.  PubMed