Anti SLC35B1 pAb (ATL-HPA057418)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057418-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC35B1
Alternative Gene Name: UGTREL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020873: 100%, ENSRNOG00000004510: 100%
Entrez Gene ID: 10237
Uniprot ID: P78383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP |
Gene Sequence | QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP |
Gene ID - Mouse | ENSMUSG00000020873 |
Gene ID - Rat | ENSRNOG00000004510 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC35B1 pAb (ATL-HPA057418) | |
Datasheet | Anti SLC35B1 pAb (ATL-HPA057418) Datasheet (External Link) |
Vendor Page | Anti SLC35B1 pAb (ATL-HPA057418) at Atlas Antibodies |
Documents & Links for Anti SLC35B1 pAb (ATL-HPA057418) | |
Datasheet | Anti SLC35B1 pAb (ATL-HPA057418) Datasheet (External Link) |
Vendor Page | Anti SLC35B1 pAb (ATL-HPA057418) |
Citations for Anti SLC35B1 pAb (ATL-HPA057418) – 1 Found |
Klein, Marie-Christine; Zimmermann, Katharina; Schorr, Stefan; Landini, Martina; Klemens, Patrick A W; Altensell, Jacqueline; Jung, Martin; Krause, Elmar; Nguyen, Duy; Helms, Volkhard; Rettig, Jens; Fecher-Trost, Claudia; Cavalié, Adolfo; Hoth, Markus; Bogeski, Ivan; Neuhaus, H Ekkehard; Zimmermann, Richard; Lang, Sven; Haferkamp, Ilka. AXER is an ATP/ADP exchanger in the membrane of the endoplasmic reticulum. Nature Communications. 2018;9(1):3489. PubMed |