Anti SLC35B1 pAb (ATL-HPA048655)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048655-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC35B1
Alternative Gene Name: UGTREL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020873: 100%, ENSRNOG00000004510: 100%
Entrez Gene ID: 10237
Uniprot ID: P78383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP |
Gene Sequence | QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP |
Gene ID - Mouse | ENSMUSG00000020873 |
Gene ID - Rat | ENSRNOG00000004510 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC35B1 pAb (ATL-HPA048655) | |
Datasheet | Anti SLC35B1 pAb (ATL-HPA048655) Datasheet (External Link) |
Vendor Page | Anti SLC35B1 pAb (ATL-HPA048655) at Atlas Antibodies |
Documents & Links for Anti SLC35B1 pAb (ATL-HPA048655) | |
Datasheet | Anti SLC35B1 pAb (ATL-HPA048655) Datasheet (External Link) |
Vendor Page | Anti SLC35B1 pAb (ATL-HPA048655) |