Anti SLC35A5 pAb (ATL-HPA057964)

Atlas Antibodies

Catalog No.:
ATL-HPA057964-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 35, member A5
Gene Name: SLC35A5
Alternative Gene Name: FLJ20730
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022664: 79%, ENSRNOG00000002069: 83%
Entrez Gene ID: 55032
Uniprot ID: Q9BS91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF
Gene Sequence KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF
Gene ID - Mouse ENSMUSG00000022664
Gene ID - Rat ENSRNOG00000002069
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC35A5 pAb (ATL-HPA057964)
Datasheet Anti SLC35A5 pAb (ATL-HPA057964) Datasheet (External Link)
Vendor Page Anti SLC35A5 pAb (ATL-HPA057964) at Atlas Antibodies

Documents & Links for Anti SLC35A5 pAb (ATL-HPA057964)
Datasheet Anti SLC35A5 pAb (ATL-HPA057964) Datasheet (External Link)
Vendor Page Anti SLC35A5 pAb (ATL-HPA057964)