Anti SLC35A5 pAb (ATL-HPA057964)

Atlas Antibodies

Catalog No.: ATL-HPA057964-25

Protein Description: solute carrier family 35, member A5
Gene Name: SLC35A5
Alternative Gene Name: FLJ20730
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022664: 79%, ENSRNOG00000002069: 83%
Entrez Gene ID: 55032
Uniprot ID: Q9BS91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF
• Gene Sequence: KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF
• Gene ID - Mouse: ENSMUSG00000022664
• Gene ID - Rat: ENSRNOG00000002069
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.