Anti SLC35A3 pAb (ATL-HPA015253)

Atlas Antibodies

Catalog No.: ATL-HPA015253-25

Protein Description: solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3
Gene Name: SLC35A3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040928: 31%, ENSRNOG00000001213: 37%
Entrez Gene ID: 23443
Uniprot ID: Q9Y2D2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKTMF
• Gene Sequence: SSRSVLSPVVGTDAPDQHLELKKPQELKEMERLPLANEDKTMF
• Gene ID - Mouse: ENSMUSG00000040928
• Gene ID - Rat: ENSRNOG00000001213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.