Anti SLC34A2 pAb (ATL-HPA066474)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066474-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SLC34A2
Alternative Gene Name: NAPI-3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029188: 59%, ENSRNOG00000004626: 61%
Entrez Gene ID: 10568
Uniprot ID: O95436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP |
| Gene Sequence | APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP |
| Gene ID - Mouse | ENSMUSG00000029188 |
| Gene ID - Rat | ENSRNOG00000004626 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC34A2 pAb (ATL-HPA066474) | |
| Datasheet | Anti SLC34A2 pAb (ATL-HPA066474) Datasheet (External Link) |
| Vendor Page | Anti SLC34A2 pAb (ATL-HPA066474) at Atlas Antibodies |
| Documents & Links for Anti SLC34A2 pAb (ATL-HPA066474) | |
| Datasheet | Anti SLC34A2 pAb (ATL-HPA066474) Datasheet (External Link) |
| Vendor Page | Anti SLC34A2 pAb (ATL-HPA066474) |