Anti SLC34A2 pAb (ATL-HPA066474)

Atlas Antibodies

Catalog No.:
ATL-HPA066474-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 34 member 2
Gene Name: SLC34A2
Alternative Gene Name: NAPI-3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029188: 59%, ENSRNOG00000004626: 61%
Entrez Gene ID: 10568
Uniprot ID: O95436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP
Gene Sequence APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP
Gene ID - Mouse ENSMUSG00000029188
Gene ID - Rat ENSRNOG00000004626
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC34A2 pAb (ATL-HPA066474)
Datasheet Anti SLC34A2 pAb (ATL-HPA066474) Datasheet (External Link)
Vendor Page Anti SLC34A2 pAb (ATL-HPA066474) at Atlas Antibodies

Documents & Links for Anti SLC34A2 pAb (ATL-HPA066474)
Datasheet Anti SLC34A2 pAb (ATL-HPA066474) Datasheet (External Link)
Vendor Page Anti SLC34A2 pAb (ATL-HPA066474)