Anti SLC34A1 pAb (ATL-HPA077175)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077175-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SLC34A1
Alternative Gene Name: NAPI-3, NPT2, NPTIIa, SLC11, SLC17A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021490: 79%, ENSRNOG00000015262: 77%
Entrez Gene ID: 6569
Uniprot ID: Q06495
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP |
| Gene Sequence | KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP |
| Gene ID - Mouse | ENSMUSG00000021490 |
| Gene ID - Rat | ENSRNOG00000015262 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SLC34A1 pAb (ATL-HPA077175) | |
| Datasheet | Anti SLC34A1 pAb (ATL-HPA077175) Datasheet (External Link) |
| Vendor Page | Anti SLC34A1 pAb (ATL-HPA077175) at Atlas Antibodies |
| Documents & Links for Anti SLC34A1 pAb (ATL-HPA077175) | |
| Datasheet | Anti SLC34A1 pAb (ATL-HPA077175) Datasheet (External Link) |
| Vendor Page | Anti SLC34A1 pAb (ATL-HPA077175) |