Anti SLC33A1 pAb (ATL-HPA060345)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060345-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SLC33A1
Alternative Gene Name: ACATN, AT-1, AT1, SPG42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027822: 71%, ENSRNOG00000010023: 74%
Entrez Gene ID: 9197
Uniprot ID: O00400
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS |
Gene Sequence | PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS |
Gene ID - Mouse | ENSMUSG00000027822 |
Gene ID - Rat | ENSRNOG00000010023 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SLC33A1 pAb (ATL-HPA060345) | |
Datasheet | Anti SLC33A1 pAb (ATL-HPA060345) Datasheet (External Link) |
Vendor Page | Anti SLC33A1 pAb (ATL-HPA060345) at Atlas Antibodies |
Documents & Links for Anti SLC33A1 pAb (ATL-HPA060345) | |
Datasheet | Anti SLC33A1 pAb (ATL-HPA060345) Datasheet (External Link) |
Vendor Page | Anti SLC33A1 pAb (ATL-HPA060345) |