Anti SLC33A1 pAb (ATL-HPA060345)

Atlas Antibodies

SKU: ATL-HPA060345-25

• 

Protein Description: solute carrier family 33 member 1
Gene Name: SLC33A1
Alternative Gene Name: ACATN, AT-1, AT1, SPG42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027822: 71%, ENSRNOG00000010023: 74%
Entrez Gene ID: 9197
Uniprot ID: O00400
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
• Gene Sequence: PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS
• Gene ID - Mouse: ENSMUSG00000027822
• Gene ID - Rat: ENSRNOG00000010023
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.