Anti SLC31A2 pAb (ATL-HPA014861)

Atlas Antibodies

Catalog No.: ATL-HPA014861-25

Protein Description: solute carrier family 31 (copper transporter), member 2
Gene Name: SLC31A2
Alternative Gene Name: COPT2, CTR2, hCTR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066152: 58%, ENSRNOG00000013631: 62%
Entrez Gene ID: 1318
Uniprot ID: O15432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
• Gene Sequence: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC
• Gene ID - Mouse: ENSMUSG00000066152
• Gene ID - Rat: ENSRNOG00000013631
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.