Anti SLC30A6 pAb (ATL-HPA055032)

Atlas Antibodies

Catalog No.:
ATL-HPA055032-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 30 (zinc transporter), member 6
Gene Name: SLC30A6
Alternative Gene Name: FLJ31101, ZNT6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024069: 89%, ENSRNOG00000005856: 89%
Entrez Gene ID: 55676
Uniprot ID: Q6NXT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVT
Gene Sequence LGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVT
Gene ID - Mouse ENSMUSG00000024069
Gene ID - Rat ENSRNOG00000005856
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC30A6 pAb (ATL-HPA055032)
Datasheet Anti SLC30A6 pAb (ATL-HPA055032) Datasheet (External Link)
Vendor Page Anti SLC30A6 pAb (ATL-HPA055032) at Atlas Antibodies

Documents & Links for Anti SLC30A6 pAb (ATL-HPA055032)
Datasheet Anti SLC30A6 pAb (ATL-HPA055032) Datasheet (External Link)
Vendor Page Anti SLC30A6 pAb (ATL-HPA055032)
Citations for Anti SLC30A6 pAb (ATL-HPA055032) – 1 Found
Suzuki, Eisuke; Ogawa, Namino; Takeda, Taka-Aki; Nishito, Yukina; Tanaka, Yu-Ki; Fujiwara, Takashi; Matsunaga, Mayu; Ueda, Sachiko; Kubo, Naoya; Tsuji, Tokuji; Fukunaka, Ayako; Yamazaki, Tomohiro; Taylor, Kathryn M; Ogra, Yasumitsu; Kambe, Taiho. Detailed analyses of the crucial functions of Zn transporter proteins in alkaline phosphatase activation. The Journal Of Biological Chemistry. 2020;295(17):5669-5684.  PubMed