Anti SLC30A3 pAb (ATL-HPA067637)

Atlas Antibodies

SKU: ATL-HPA067637-25

• 

Protein Description: solute carrier family 30 (zinc transporter), member 3
Gene Name: SLC30A3
Alternative Gene Name: ZNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029151: 75%, ENSRNOG00000006204: 71%
Entrez Gene ID: 7781
Uniprot ID: Q99726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL
• Gene Sequence: GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL
• Gene ID - Mouse: ENSMUSG00000029151
• Gene ID - Rat: ENSRNOG00000006204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.