Anti SLC30A3 pAb (ATL-HPA067637)

Atlas Antibodies

Catalog No.:
ATL-HPA067637-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 30 (zinc transporter), member 3
Gene Name: SLC30A3
Alternative Gene Name: ZNT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029151: 75%, ENSRNOG00000006204: 71%
Entrez Gene ID: 7781
Uniprot ID: Q99726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL
Gene Sequence GLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERLHARRQL
Gene ID - Mouse ENSMUSG00000029151
Gene ID - Rat ENSRNOG00000006204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC30A3 pAb (ATL-HPA067637)
Datasheet Anti SLC30A3 pAb (ATL-HPA067637) Datasheet (External Link)
Vendor Page Anti SLC30A3 pAb (ATL-HPA067637) at Atlas Antibodies

Documents & Links for Anti SLC30A3 pAb (ATL-HPA067637)
Datasheet Anti SLC30A3 pAb (ATL-HPA067637) Datasheet (External Link)
Vendor Page Anti SLC30A3 pAb (ATL-HPA067637)