Anti SLC30A10 pAb (ATL-HPA064547)

Atlas Antibodies

Catalog No.:
ATL-HPA064547-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 30 member 10
Gene Name: SLC30A10
Alternative Gene Name: DKFZp547M236, ZnT-10, ZNT8, ZRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026614: 75%, ENSRNOG00000002397: 80%
Entrez Gene ID: 55532
Uniprot ID: Q6XR72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL
Gene Sequence SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL
Gene ID - Mouse ENSMUSG00000026614
Gene ID - Rat ENSRNOG00000002397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC30A10 pAb (ATL-HPA064547)
Datasheet Anti SLC30A10 pAb (ATL-HPA064547) Datasheet (External Link)
Vendor Page Anti SLC30A10 pAb (ATL-HPA064547) at Atlas Antibodies

Documents & Links for Anti SLC30A10 pAb (ATL-HPA064547)
Datasheet Anti SLC30A10 pAb (ATL-HPA064547) Datasheet (External Link)
Vendor Page Anti SLC30A10 pAb (ATL-HPA064547)