Anti SLC2A8 pAb (ATL-HPA011935)

Atlas Antibodies

Catalog No.: ATL-HPA011935-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 8
Gene Name: SLC2A8
Alternative Gene Name: GLUT8, GLUTX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026791: 83%, ENSRNOG00000022274: 77%
Entrez Gene ID: 29988
Uniprot ID: Q9NY64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP
• Gene Sequence: PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP
• Gene ID - Mouse: ENSMUSG00000026791
• Gene ID - Rat: ENSRNOG00000022274
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.