Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA075145-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 2 member 5
Gene Name: SLC2A5
Alternative Gene Name: GLUT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028976: 70%, ENSRNOG00000017693: 73%
Entrez Gene ID: 6518
Uniprot ID: P22732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ
Gene Sequence VPETKAKTFIEINQIFTKMNKVSEVYPEKEELKELPPVTSEQ
Gene ID - Mouse ENSMUSG00000028976
Gene ID - Rat ENSRNOG00000017693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation)
Datasheet Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation)
Datasheet Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SLC2A5 pAb (ATL-HPA075145 w/enhanced validation)