Anti SLC2A11 pAb (ATL-HPA071184)

Atlas Antibodies

Catalog No.:
ATL-HPA071184-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: solute carrier family 2 (facilitated glucose transporter), member 11
Gene Name: SLC2A11
Alternative Gene Name: GLUT10, GLUT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031641: 43%, ENSRNOG00000024411: 40%
Entrez Gene ID: 66035
Uniprot ID: Q9BYW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL
Gene Sequence KTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL
Gene ID - Mouse ENSMUSG00000031641
Gene ID - Rat ENSRNOG00000024411
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC2A11 pAb (ATL-HPA071184)
Datasheet Anti SLC2A11 pAb (ATL-HPA071184) Datasheet (External Link)
Vendor Page Anti SLC2A11 pAb (ATL-HPA071184) at Atlas Antibodies

Documents & Links for Anti SLC2A11 pAb (ATL-HPA071184)
Datasheet Anti SLC2A11 pAb (ATL-HPA071184) Datasheet (External Link)
Vendor Page Anti SLC2A11 pAb (ATL-HPA071184)