Anti SLC2A11 pAb (ATL-HPA071184)

Atlas Antibodies

Catalog No.: ATL-HPA071184-25

Protein Description: solute carrier family 2 (facilitated glucose transporter), member 11
Gene Name: SLC2A11
Alternative Gene Name: GLUT10, GLUT11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031641: 43%, ENSRNOG00000024411: 40%
Entrez Gene ID: 66035
Uniprot ID: Q9BYW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL
• Gene Sequence: KTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL
• Gene ID - Mouse: ENSMUSG00000031641
• Gene ID - Rat: ENSRNOG00000024411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.