Anti SLC29A3 pAb (ATL-HPA057905)

Atlas Antibodies

Catalog No.:
ATL-HPA057905-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: solute carrier family 29 (equilibrative nucleoside transporter), member 3
Gene Name: SLC29A3
Alternative Gene Name: ENT3, FLJ11160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020100: 80%, ENSRNOG00000000568: 80%
Entrez Gene ID: 55315
Uniprot ID: Q9BZD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEYWMFKLRNSSSPATGEDPEGSDILNYFE
Gene Sequence KEYWMFKLRNSSSPATGEDPEGSDILNYFE
Gene ID - Mouse ENSMUSG00000020100
Gene ID - Rat ENSRNOG00000000568
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC29A3 pAb (ATL-HPA057905)
Datasheet Anti SLC29A3 pAb (ATL-HPA057905) Datasheet (External Link)
Vendor Page Anti SLC29A3 pAb (ATL-HPA057905) at Atlas Antibodies

Documents & Links for Anti SLC29A3 pAb (ATL-HPA057905)
Datasheet Anti SLC29A3 pAb (ATL-HPA057905) Datasheet (External Link)
Vendor Page Anti SLC29A3 pAb (ATL-HPA057905)