Anti SLC27A3 pAb (ATL-HPA067508)

Atlas Antibodies

SKU:
ATL-HPA067508-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 27 (fatty acid transporter), member 3
Gene Name: SLC27A3
Alternative Gene Name: ACSVL3, FATP3, MGC4365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027932: 88%, ENSRNOG00000015421: 89%
Entrez Gene ID: 11000
Uniprot ID: Q5K4L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFR
Gene Sequence DTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFR
Gene ID - Mouse ENSMUSG00000027932
Gene ID - Rat ENSRNOG00000015421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SLC27A3 pAb (ATL-HPA067508)
Datasheet Anti SLC27A3 pAb (ATL-HPA067508) Datasheet (External Link)
Vendor Page Anti SLC27A3 pAb (ATL-HPA067508) at Atlas Antibodies

Documents & Links for Anti SLC27A3 pAb (ATL-HPA067508)
Datasheet Anti SLC27A3 pAb (ATL-HPA067508) Datasheet (External Link)
Vendor Page Anti SLC27A3 pAb (ATL-HPA067508)