Anti SLC25A51 pAb (ATL-HPA058261)

Atlas Antibodies

Catalog No.:
ATL-HPA058261-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25, member 51
Gene Name: SLC25A51
Alternative Gene Name: CG7943, MCART1, MGC14836
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045973: 83%, ENSRNOG00000039278: 69%
Entrez Gene ID: 92014
Uniprot ID: Q9H1U9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLC
Gene Sequence MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLC
Gene ID - Mouse ENSMUSG00000045973
Gene ID - Rat ENSRNOG00000039278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A51 pAb (ATL-HPA058261)
Datasheet Anti SLC25A51 pAb (ATL-HPA058261) Datasheet (External Link)
Vendor Page Anti SLC25A51 pAb (ATL-HPA058261) at Atlas Antibodies

Documents & Links for Anti SLC25A51 pAb (ATL-HPA058261)
Datasheet Anti SLC25A51 pAb (ATL-HPA058261) Datasheet (External Link)
Vendor Page Anti SLC25A51 pAb (ATL-HPA058261)