Anti SLC25A46 pAb (ATL-HPA071582)

Atlas Antibodies

Catalog No.:
ATL-HPA071582-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25, member 46
Gene Name: SLC25A46
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024259: 97%, ENSRNOG00000017091: 95%
Entrez Gene ID: 91137
Uniprot ID: Q96AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI
Gene Sequence LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLHRLHIQGTRTIIDNTDLGYEVLPI
Gene ID - Mouse ENSMUSG00000024259
Gene ID - Rat ENSRNOG00000017091
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A46 pAb (ATL-HPA071582)
Datasheet Anti SLC25A46 pAb (ATL-HPA071582) Datasheet (External Link)
Vendor Page Anti SLC25A46 pAb (ATL-HPA071582) at Atlas Antibodies

Documents & Links for Anti SLC25A46 pAb (ATL-HPA071582)
Datasheet Anti SLC25A46 pAb (ATL-HPA071582) Datasheet (External Link)
Vendor Page Anti SLC25A46 pAb (ATL-HPA071582)