Anti SLC25A45 pAb (ATL-HPA050821)

Atlas Antibodies

Catalog No.: ATL-HPA050821-25

Protein Description: solute carrier family 25, member 45
Gene Name: SLC25A45
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024818: 84%, ENSRNOG00000030616: 84%
Entrez Gene ID: 283130
Uniprot ID: Q8N413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQN
• Gene Sequence: FDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQN
• Gene ID - Mouse: ENSMUSG00000024818
• Gene ID - Rat: ENSRNOG00000030616
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.