Anti SLC25A45 pAb (ATL-HPA050821)

Atlas Antibodies

Catalog No.:
ATL-HPA050821-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25, member 45
Gene Name: SLC25A45
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024818: 84%, ENSRNOG00000030616: 84%
Entrez Gene ID: 283130
Uniprot ID: Q8N413
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQN
Gene Sequence FDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQN
Gene ID - Mouse ENSMUSG00000024818
Gene ID - Rat ENSRNOG00000030616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A45 pAb (ATL-HPA050821)
Datasheet Anti SLC25A45 pAb (ATL-HPA050821) Datasheet (External Link)
Vendor Page Anti SLC25A45 pAb (ATL-HPA050821) at Atlas Antibodies

Documents & Links for Anti SLC25A45 pAb (ATL-HPA050821)
Datasheet Anti SLC25A45 pAb (ATL-HPA050821) Datasheet (External Link)
Vendor Page Anti SLC25A45 pAb (ATL-HPA050821)