Anti SLC25A44 pAb (ATL-HPA065411)

Atlas Antibodies

Catalog No.:
ATL-HPA065411-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25, member 44
Gene Name: SLC25A44
Alternative Gene Name: FLJ90431, KIAA0446
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050144: 92%, ENSRNOG00000025269: 92%
Entrez Gene ID: 9673
Uniprot ID: Q96H78
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGF
Gene Sequence VVSQHLMMQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGF
Gene ID - Mouse ENSMUSG00000050144
Gene ID - Rat ENSRNOG00000025269
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A44 pAb (ATL-HPA065411)
Datasheet Anti SLC25A44 pAb (ATL-HPA065411) Datasheet (External Link)
Vendor Page Anti SLC25A44 pAb (ATL-HPA065411) at Atlas Antibodies

Documents & Links for Anti SLC25A44 pAb (ATL-HPA065411)
Datasheet Anti SLC25A44 pAb (ATL-HPA065411) Datasheet (External Link)
Vendor Page Anti SLC25A44 pAb (ATL-HPA065411)