Anti SLC25A40 pAb (ATL-HPA055197)

Atlas Antibodies

Catalog No.:
ATL-HPA055197-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: solute carrier family 25, member 40
Gene Name: SLC25A40
Alternative Gene Name: MCFP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054099: 80%, ENSRNOG00000022837: 78%
Entrez Gene ID: 55972
Uniprot ID: Q8TBP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIK
Gene Sequence FVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIK
Gene ID - Mouse ENSMUSG00000054099
Gene ID - Rat ENSRNOG00000022837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SLC25A40 pAb (ATL-HPA055197)
Datasheet Anti SLC25A40 pAb (ATL-HPA055197) Datasheet (External Link)
Vendor Page Anti SLC25A40 pAb (ATL-HPA055197) at Atlas Antibodies

Documents & Links for Anti SLC25A40 pAb (ATL-HPA055197)
Datasheet Anti SLC25A40 pAb (ATL-HPA055197) Datasheet (External Link)
Vendor Page Anti SLC25A40 pAb (ATL-HPA055197)