Anti SLC25A40 pAb (ATL-HPA055197)

Atlas Antibodies

Catalog No.: ATL-HPA055197-25

Protein Description: solute carrier family 25, member 40
Gene Name: SLC25A40
Alternative Gene Name: MCFP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054099: 80%, ENSRNOG00000022837: 78%
Entrez Gene ID: 55972
Uniprot ID: Q8TBP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIK
• Gene Sequence: FVYSNGLMDHLCVCEEGGNKLWYKKPGNFQGTLDAFFKIIRNEGIK
• Gene ID - Mouse: ENSMUSG00000054099
• Gene ID - Rat: ENSRNOG00000022837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.